Recombinant Human MYO7B
Cat.No. : | MYO7B-29760TH |
Product Overview : | Recombinant fragment of Human MYO7B with N-terminal proprietary tag. Predicted MW 36.30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 97 amino acids |
Molecular Weight : | 36.300kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFT |
Sequence Similarities : | Contains 2 FERM domains.Contains 6 IQ domains.Contains 1 myosin head-like domain.Contains 3 MyTH4 domains.Contains 2 SH3 domains. |
Gene Name | MYO7B myosin VIIB [ Homo sapiens ] |
Official Symbol | MYO7B |
Synonyms | MYO7B; myosin VIIB; myosin-VIIb; |
Gene ID | 4648 |
mRNA Refseq | NM_001080527 |
Protein Refseq | NP_001073996 |
MIM | 606541 |
Uniprot ID | Q6PIF6 |
Chromosome Location | 2q21.1 |
Function | ATP binding; actin binding; motor activity; nucleotide binding; |
◆ Recombinant Proteins | ||
MYO7B-29760TH | Recombinant Human MYO7B | +Inquiry |
MYO7B-5862M | Recombinant Mouse MYO7B Protein, His (Fc)-Avi-tagged | +Inquiry |
MYO7B-10345M | Recombinant Mouse MYO7B Protein | +Inquiry |
MYO7B-5845H | Recombinant Human MYO7B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYO7B Products
Required fields are marked with *
My Review for All MYO7B Products
Required fields are marked with *