Recombinant Human MYO7B

• Cat.No.: MYO7B-29760TH
• Product Overview: Recombinant fragment of Human MYO7B with N-terminal proprietary tag. Predicted MW 36.30 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 97 amino acids
• Molecular Weight: 36.300kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQNDRTGKTGLVPMACLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFT
• Sequence Similarities: Contains 2 FERM domains.Contains 6 IQ domains.Contains 1 myosin head-like domain.Contains 3 MyTH4 domains.Contains 2 SH3 domains.

Gene Information

• Gene Name: MYO7B myosin VIIB [ Homo sapiens ]
• Official Symbol: MYO7B
• Synonyms: MYO7B; myosin VIIB; myosin-VIIb
• Gene ID: 4648
• mRNA Refseq: NM_001080527
• Protein Refseq: NP_001073996
• MIM: 606541
• Uniprot ID: Q6PIF6
• Chromosome Location: 2q21.1
• Function: ATP binding; actin binding; motor activity; nucleotide binding