"NDUFB6" Related Products

Expand
Expand

Recombinant Human NDUFB6

Cat.No.: NDUFB6-29478TH
Product Overview: Recombinant fragment of Human NDUFB6 with a N terminal proprietary tag; Predicted MWt 39.82 kDa.
Description: The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.
Protein length: 128 amino acids
Molecular Weight: 39.820kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKM GPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVW IIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM KEFPDQHH
Sequence Similarities: Belongs to the complex I NDUFB6 subunit family.
Gene Name: NDUFB6 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa [ Homo sapiens ]
Official Symbol: NDUFB6
Synonyms: NDUFB6; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; B17; CI; complex I; mitochondrial respiratory chain; B17 su
Gene ID: 4712
mRNA Refseq: NM_001199987
Protein Refseq: NP_001186916
MIM: 603322
Uniprot ID: O95139
Chromosome Location: 9p13.2
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function: NADH dehydrogenase (ubiquinone) activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.