Recombinant Full Length Pan Troglodytes Nadh Dehydrogenase [Ubiquinone] 1 Beta Subcomplex Subunit 6(Ndufb6) Protein, His-Tagged
| Cat.No. : | RFL29588PF |
| Product Overview : | Recombinant Full Length Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6(NDUFB6) Protein (Q0MQE1) (2-128aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pan troglodytes |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-128) |
| Form : | Lyophilized powder |
| AA Sequence : | TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMV HGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMK EFPDQHH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | NDUFB6 |
| Synonyms | NDUFB6; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit |
| UniProt ID | Q0MQE1 |
| ◆ Recombinant Proteins | ||
| NDUFB6-2984R | Recombinant Rhesus monkey NDUFB6 Protein, His-tagged | +Inquiry |
| NDUFB6-2803R | Recombinant Rhesus Macaque NDUFB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NDUFB6-4914C | Recombinant Chicken NDUFB6 | +Inquiry |
| RFL29588PF | Recombinant Full Length Pan Troglodytes Nadh Dehydrogenase [Ubiquinone] 1 Beta Subcomplex Subunit 6(Ndufb6) Protein, His-Tagged | +Inquiry |
| NDUFB6-11064Z | Recombinant Zebrafish NDUFB6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFB6-1178HCL | Recombinant Human NDUFB6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFB6 Products
Required fields are marked with *
My Review for All NDUFB6 Products
Required fields are marked with *
