Recombinant Human NFKBIA, His-tagged
Cat.No. : | NFKBIA-28232TH |
Product Overview : | Recombinant full length Human IKB alpha with N terminal His tag; 337 amino acids with tag, Predicted MWt 37.7 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. |
Protein length : | 317 amino acids |
Conjugation : | HIS |
Molecular Weight : | 37.700kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 20% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMFQAAERPQEWAMEGPRDGL KKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQE VPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVK GDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCD PELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSIL KATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEP CNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPY QLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTE SEFTEFTEDELPYDDCVFGGQRLTL |
Sequence Similarities : | Belongs to the NF-kappa-B inhibitor family.Contains 5 ANK repeats. |
Gene Name : | NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha [ Homo sapiens ] |
Official Symbol : | NFKBIA |
Synonyms : | NFKBIA; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha; NFKBI; NF-kappa-B inhibitor alpha; IkappaBalpha; IKBA; MAD 3; |
Gene ID : | 4792 |
mRNA Refseq : | NM_020529 |
Protein Refseq : | NP_065390 |
MIM : | 164008 |
Uniprot ID : | P25963 |
Chromosome Location : | 14q13 |
Pathway : | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; |
Function : | NF-kappaB binding; NF-kappaB binding; enzyme binding; heat shock protein binding; identical protein binding; |
Products Types
◆ Recombinant Protein | ||
NFKBIA-6039M | Recombinant Mouse NFKBIA Protein, His (Fc)-Avi-tagged | +Inquiry |
NFKBIA-3340H | Recombinant Human NFKBIA protein(Phe2-Leu317), His-tagged | +Inquiry |
NFKBIA-3634R | Recombinant Rat NFKBIA Protein, His (Fc)-Avi-tagged | +Inquiry |
NFKBIA-2835R | Recombinant Rhesus Macaque NFKBIA Protein, His (Fc)-Avi-tagged | +Inquiry |
Nfkbia-4398M | Recombinant Mouse Nfkbia Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
NFKBIA-437HCL | Recombinant Human NFKBIA lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket