"NFKBIA" Related Products

Expand
Expand
Expand

Recombinant Human NFKBIA, His-tagged

Cat.No.: NFKBIA-28232TH
Product Overview: Recombinant full length Human IKB alpha with N terminal His tag; 337 amino acids with tag, Predicted MWt 37.7 kDa.
Description: This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease.
Protein length: 317 amino acids
Conjugation: HIS
Molecular Weight: 37.700kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 20% Glycerol, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMFQAAERPQEWAMEGPRDGL KKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQE VPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVK GDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCD PELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSIL KATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEP CNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPY QLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTE SEFTEFTEDELPYDDCVFGGQRLTL
Sequence Similarities: Belongs to the NF-kappa-B inhibitor family.Contains 5 ANK repeats.
Gene Name: NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha [ Homo sapiens ]
Official Symbol: NFKBIA
Synonyms: NFKBIA; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha; NFKBI; NF-kappa-B inhibitor alpha; IkappaBalpha; IKBA; MAD 3;
Gene ID: 4792
mRNA Refseq: NM_020529
Protein Refseq: NP_065390
MIM: 164008
Uniprot ID: P25963
Chromosome Location: 14q13
Pathway: Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem;
Function: NF-kappaB binding; NF-kappaB binding; enzyme binding; heat shock protein binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.