"NKX3-1" Related Products

Recombinant Human NKX3-1

Cat.No.: NKX3-1-28096TH
Product Overview: Recombinant fragment of Human Nkx3.1 with N terminal proprietary tag, 37.73kDa.
Description: The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in the prostate and, at a lower level, in the testis.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIEL ERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT KRKQLSSELGDLEKHSSLPALKEEAFSRAS
Sequence Similarities: Belongs to the NK-3 homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: NKX3-1 NK3 homeobox 1 [ Homo sapiens ]
Official Symbol: NKX3-1
Synonyms: NKX3-1; NK3 homeobox 1; NK homeobox (Drosophila), family 3, A , NK3 transcription factor related, locus 1 (Drosophila) , NKX3A; homeobox protein Nkx-3.1; BAPX2; NKX3.1;
Gene ID: 4824
mRNA Refseq: NM_006167
Protein Refseq: NP_006158
MIM: 602041
Uniprot ID: Q99801
Chromosome Location: 8p21.2
Pathway: Coregulation of Androgen receptor activity, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem;
Function: androgen receptor activity; core promoter binding; contributes_to cysteine-type endopeptidase activator activity involved in apoptotic process; estrogen receptor activity; estrogen receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.