Recombinant Human NKX3-1

• Cat.No.: NKX3-1-28096TH
• Product Overview: Recombinant fragment of Human Nkx3.1 with N terminal proprietary tag, 37.73kDa.

Specification

• Description: The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Highly expressed in the prostate and, at a lower level, in the testis.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIEL ERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT KRKQLSSELGDLEKHSSLPALKEEAFSRAS
• Sequence Similarities: Belongs to the NK-3 homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: NKX3-1 NK3 homeobox 1 [ Homo sapiens ]
• Official Symbol: NKX3-1
• Synonyms: NKX3-1; NK3 homeobox 1; NK homeobox (Drosophila), family 3, A , NK3 transcription factor related, locus 1 (Drosophila) , NKX3A; homeobox protein Nkx-3.1; BAPX2; NKX3.1
• Gene ID: 4824
• mRNA Refseq: NM_006167
• Protein Refseq: NP_006158
• MIM: 602041
• Uniprot ID: Q99801
• Chromosome Location: 8p21.2
• Pathway: Coregulation of Androgen receptor activity, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem
• Function: androgen receptor activity; core promoter binding; contributes_to cysteine-type endopeptidase activator activity involved in apoptotic process; estrogen receptor activity; estrogen receptor binding