"NNAT" Related Products

Recombinant Human NNAT

Cat.No.: NNAT-29654TH
Product Overview: Recombinant full length Human Neuronatin with a proprietary tag; Predicted MWt 34.65 kDa including tag.
Description: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.
Protein length: 81 amino acids
Molecular Weight: 34.650kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
Sequence Similarities: Belongs to the neuronatin family.
Gene Name: NNAT neuronatin [ Homo sapiens ]
Official Symbol: NNAT
Synonyms: NNAT; neuronatin; Peg5;
Gene ID: 4826
mRNA Refseq: NM_005386
Protein Refseq: NP_005377
MIM: 603106
Uniprot ID: Q16517
Chromosome Location: 20q11.2-q12

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.