Recombinant Full Length Human NNAT Protein
| Cat.No. : | NNAT-342HF |
| Product Overview : | Recombinant full length Human Neuronatin with a proprietary tag; Predicted MWt 34.65 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 81 amino acids |
| Description : | The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 34.650kDa inclusive of tags |
| AA Sequence : | MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | NNAT neuronatin [ Homo sapiens ] |
| Official Symbol | NNAT |
| Synonyms | NNAT; neuronatin; Peg5 |
| Gene ID | 4826 |
| mRNA Refseq | NM_005386 |
| Protein Refseq | NP_005377 |
| MIM | 603106 |
| UniProt ID | Q16517 |
| ◆ Recombinant Proteins | ||
| NNAT-3672R | Recombinant Rat NNAT Protein, His (Fc)-Avi-tagged | +Inquiry |
| NNAT-5954H | Recombinant Human NNAT Protein, GST-tagged | +Inquiry |
| NNAT-1319H | Recombinant Human NNAT, GST-tagged | +Inquiry |
| NNAT-10758M | Recombinant Mouse NNAT Protein | +Inquiry |
| NNAT-6667HF | Recombinant Full Length Human NNAT Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NNAT Products
Required fields are marked with *
My Review for All NNAT Products
Required fields are marked with *
