"NPEPL1" Related Products

Expand

Recombinant Human NPEPL1, His-tagged

Cat.No.: NPEPL1-30175TH
Product Overview: Recombinant fragment, corresponding to amino acids 206-518 of Human NPEPL1 with N terminal His tag; 36 kDa
Description: NPEPL1 probably catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 100 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KELGIIPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLS HTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRD CGGAAAVLGAFRAAIKQGFKDNLHAVFCLAENSVGPNA TRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKD LGADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVK AGRKCGDLVHPLVYCPELHFSEFTSAVADMKNSVADRD NSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERA TGFGVALLLALFGRASEDPLLNLVSPLGCEVDVEEGDL GRDSK
Gene Name: NPEPL1 aminopeptidase-like 1 [ Homo sapiens ]
Official Symbol: NPEPL1
Synonyms: NPEPL1; aminopeptidase-like 1; probable aminopeptidase NPEPL1; bA261P9.2; FLJ11583;
Gene ID: 79716
mRNA Refseq: NM_001204872
Protein Refseq: NP_001191801
Uniprot ID: Q8NDH3
Chromosome Location: 20q13.32
Function: aminopeptidase activity; manganese ion binding; metal ion binding; metalloexopeptidase activity; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.