"NR6A1" Related Products

Expand
Expand

Recombinant Human NR6A1

Cat.No.: NR6A1-26466TH
Product Overview: Recombinant full length Human GCNF isoform 2 with N-terminal proprietary tag.Mol Wt 80.9 kDa inclusive of tag.
Description: This gene encodes an orphan nuclear receptor which is a member of the nuclear hormone receptor family. Its expression pattern suggests that it may be involved in neurogenesis and germ cell development. The protein can homodimerize and bind DNA, but in vivo targets have not been identified. The gene expresses at least alternatively spliced transcript variants.
Protein length: 475 amino acids
Molecular Weight: 80.900kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Shows highest expression in the germ cells of the adult testis.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDEL AELDPGTNDRAEQRTCLICGDRATGLHYGIISCEGCKGFF KRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMG MNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEE EANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSRSVELN GFMAFREQYMGMSVPPHYQYIPHLFSYSGHSPLLPQQARS LDPQSYSLIHQLLSAEDLE PLGTPMLIED GYAVTQAELF ALLCRLADEL LFRQIAWIKK LPFFCELSIK DYTCLLSSTW QELILLSSLT VYSKQIFGEL ADVTAKYSPS DEELHRFSDE GMEVIERLIY LYHKFHQLKV SNEEYACMKA INFLNQDIRG LTSASQLEQL NKRYWYICQD FTEYKYTHQP NRFPDLMMCL PEIRYIAGKM VNVPLEQLPL LFKVVLHSCK TSVGKE
Sequence Similarities: Belongs to the nuclear hormone receptor family. NR6 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name: NR6A1 nuclear receptor subfamily 6, group A, member 1 [ Homo sapiens ]
Official Symbol: NR6A1
Synonyms: NR6A1; nuclear receptor subfamily 6, group A, member 1; GCNF; nuclear receptor subfamily 6 group A member 1; GCNF1; RTR;
Gene ID: 2649
mRNA Refseq: NM_001489
Protein Refseq: NP_001480
MIM: 602778
Uniprot ID: Q15406
Chromosome Location: 9q33.3
Pathway: Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem;
Function: DNA binding; ligand-dependent nuclear receptor activity; metal ion binding; protein homodimerization activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.