"OLA1" Related Products

Expand

Recombinant Human OLA1, His-tagged

Cat.No.: OLA1-29179TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-238 of Human GTPBP9 with an N terminal His tag. Predicted mwt: 29 kDa;
Description: GTPBP9 belongs to the GTP1/OBG family. It hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. It has lower affinity for GTP..
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKK PVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDY IRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQEL SAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPD EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYED FKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTP QQPKKK
Gene Name: OLA1 Obg-like ATPase 1 [ Homo sapiens ]
Official Symbol: OLA1
Synonyms: OLA1; Obg-like ATPase 1; GTP binding protein 9 (putative) , GTPBP9; obg-like ATPase 1; PTD004;
Gene ID: 29789
mRNA Refseq: NM_001011708
Protein Refseq: NP_001011708
MIM: 611175
Uniprot ID: Q9NTK5
Chromosome Location: 2q31.1
Function: ATP binding; GTP binding; hydrolase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.