Recombinant Human OLA1, His-tagged
Cat.No. : | OLA1-29179TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-238 of Human GTPBP9 with an N terminal His tag. Predicted mwt: 29 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-238 a.a. |
Description : | GTPBP9 belongs to the GTP1/OBG family. It hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. It has lower affinity for GTP.. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKK PVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDY IRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQEL SAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPD EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYED FKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTP QQPKKK |
Full Length : | Full L. |
Gene Name | OLA1 Obg-like ATPase 1 [ Homo sapiens ] |
Official Symbol | OLA1 |
Synonyms | OLA1; Obg-like ATPase 1; GTP binding protein 9 (putative) , GTPBP9; obg-like ATPase 1; PTD004; |
Gene ID | 29789 |
mRNA Refseq | NM_001011708 |
Protein Refseq | NP_001011708 |
MIM | 611175 |
Uniprot ID | Q9NTK5 |
Chromosome Location | 2q31.1 |
Function | ATP binding; GTP binding; hydrolase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
OLA1-11094M | Recombinant Mouse OLA1 Protein | +Inquiry |
OLA1-3162R | Recombinant Rhesus monkey OLA1 Protein, His-tagged | +Inquiry |
OLA1-3533H | Recombinant Human OLA1 protein, His-tagged | +Inquiry |
OLA1-2523H | Recombinant Human Obg-Like ATPase 1, His-tagged | +Inquiry |
OLA1-8352Z | Recombinant Zebrafish OLA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLA1-3586HCL | Recombinant Human OLA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLA1 Products
Required fields are marked with *
My Review for All OLA1 Products
Required fields are marked with *