"OTX1" Related Products

Expand

Recombinant Human OTX1

Cat.No.: OTX1-30526TH
Product Overview: Recombinant fragment corresponding to amino acids 10-116 of Human Otx1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa.
Description: This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mouse is required for proper brain and sensory organ development and can cause epilepsy. Alternate splicing results in two transcript variants that encoded the same protein.
Protein length: 107 amino acids
Molecular Weight: 37.400kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQ LDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNR RAKCRQQQQSGSGTKSRPAKKKSSPVR
Sequence Similarities: Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name: OTX1 orthodenticle homeobox 1 [ Homo sapiens ]
Official Symbol: OTX1
Synonyms: OTX1; orthodenticle homeobox 1; orthodenticle (Drosophila) homolog 1 , orthodenticle homolog 1 (Drosophila); homeobox protein OTX1;
Gene ID: 5013
mRNA Refseq: NM_001199770
Protein Refseq: NP_001186699
MIM: 600036
Uniprot ID: P32242
Chromosome Location: 2p15
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.