Recombinant Human OTX1
Cat.No. : | OTX1-30526TH |
Product Overview : | Recombinant fragment corresponding to amino acids 10-116 of Human Otx1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mouse is required for proper brain and sensory organ development and can cause epilepsy. Alternate splicing results in two transcript variants that encoded the same protein. |
Protein length : | 107 amino acids |
Molecular Weight : | 37.400kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQ LDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNR RAKCRQQQQSGSGTKSRPAKKKSSPVR |
Sequence Similarities : | Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain. |
Gene Name : | OTX1 orthodenticle homeobox 1 [ Homo sapiens ] |
Official Symbol : | OTX1 |
Synonyms : | OTX1; orthodenticle homeobox 1; orthodenticle (Drosophila) homolog 1 , orthodenticle homolog 1 (Drosophila); homeobox protein OTX1; |
Gene ID : | 5013 |
mRNA Refseq : | NM_001199770 |
Protein Refseq : | NP_001186699 |
MIM : | 600036 |
Uniprot ID : | P32242 |
Chromosome Location : | 2p15 |
Function : | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
OTX1-3882R | Recombinant Rat OTX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OTX1-6441M | Recombinant Mouse OTX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OTX1-12247M | Recombinant Mouse OTX1 Protein | +Inquiry |
OTX1-4220R | Recombinant Rat OTX1 Protein | +Inquiry |
OTX1-761H | Recombinant Human OTX1 Protein, GST-His-tagged | +Inquiry |
◆ Lysates | ||
OTX1-3512HCL | Recombinant Human OTX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket