Recombinant Human OTX1

• Cat.No.: OTX1-30526TH
• Product Overview: Recombinant fragment corresponding to amino acids 10-116 of Human Otx1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 107 amino acids
• Description: This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mouse is required for proper brain and sensory organ development and can cause epilepsy. Alternate splicing results in two transcript variants that encoded the same protein.
• Molecular Weight: 37.400kDa inclusive of tags
• Tissue specificity: Expressed in brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQ LDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNR RAKCRQQQQSGSGTKSRPAKKKSSPVR
• Sequence Similarities: Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: OTX1 orthodenticle homeobox 1 [ Homo sapiens ]
• Official Symbol: OTX1
• Synonyms: OTX1; orthodenticle homeobox 1; orthodenticle (Drosophila) homolog 1 , orthodenticle homolog 1 (Drosophila); homeobox protein OTX1
• Gene ID: 5013
• mRNA Refseq: NM_001199770
• Protein Refseq: NP_001186699
• MIM: 600036
• Uniprot ID: P32242
• Chromosome Location: 2p15
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity