"PAFAH1B3" Related Products

Expand
Expand

Recombinant Human PAFAH1B3

Cat.No.: PAFAH1B3-28937TH
Product Overview: Recombinant full length Human PAFAH1B3 with N-terminal proprietary tag. Predicted MW 51.52kDa.
Description: This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described.
Protein length: 231 amino acids
Molecular Weight: 51.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: In the adult, expressed in brain, skeletal muscle, kidney, thymus, spleen, colon, testis, ovary and peripheral blood leukocytes. In the fetus, highest expression occurs in brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPE VVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHV LWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVR AALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG YTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Sequence Similarities: Belongs to the GDSL lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily.
Gene Name: PAFAH1B3 platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) [ Homo sapiens ]
Official Symbol: PAFAH1B3
Synonyms: PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD) , platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa , platelet a
Gene ID: 5050
mRNA Refseq: NM_001145939
Protein Refseq: NP_001139411
MIM: 603074
Uniprot ID: Q15102
Chromosome Location: 19q13.1
Pathway: Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem; Lissencephaly gene (LIS1) in neuronal migration and development, organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function: 1-alkyl-2-acetylglycerophosphocholine esterase activity; hydrolase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.