Recombinant Human PAFAH1B3

• Cat.No.: PAFAH1B3-28937TH
• Product Overview: Recombinant full length Human PAFAH1B3 with N-terminal proprietary tag. Predicted MW 51.52kDa.

Specification

• Description: This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described.
• Protein length: 231 amino acids
• Molecular Weight: 51.520kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: In the adult, expressed in brain, skeletal muscle, kidney, thymus, spleen, colon, testis, ovary and peripheral blood leukocytes. In the fetus, highest expression occurs in brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPE VVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHV LWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAI VQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVR AALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG YTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
• Sequence Similarities: Belongs to the GDSL lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily.

Gene Information

• Gene Name: PAFAH1B3 platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa) [ Homo sapiens ]
• Official Symbol: PAFAH1B3
• Synonyms: PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD) , platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa , platelet a
• Gene ID: 5050
• mRNA Refseq: NM_001145939
• Protein Refseq: NP_001139411
• MIM: 603074
• Uniprot ID: Q15102
• Chromosome Location: 19q13.1
• Pathway: Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem; Lissencephaly gene (LIS1) in neuronal migration and development, organism-specific biosystem; Metabolic pathways, organism-specific biosystem
• Function: 1-alkyl-2-acetylglycerophosphocholine esterase activity; hydrolase activity; protein binding