Recombinant Human PAFAH1B3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PAFAH1B3-1613H |
Product Overview : | PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_002564) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PAFAH1B3 platelet activating factor acetylhydrolase 1b catalytic subunit 3 [ Homo sapiens (human) ] |
Official Symbol | PAFAH1B3 |
Synonyms | PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD), platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, platelet activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa); platelet-activating factor acetylhydrolase IB subunit gamma; PAF AH1b alpha 1 subunit; PAFAH subunit gamma; PAF-AH subunit gamma; PAF-AH 29 kDa subunit; PAF-AH1b alpha 1 subunit; PAF acetylhydrolase 29 kDa subunit; platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa); PAFAHG; FLJ44990; |
Gene ID | 5050 |
mRNA Refseq | NM_002573 |
Protein Refseq | NP_002564 |
MIM | 603074 |
UniProt ID | Q15102 |
◆ Recombinant Proteins | ||
Pafah1b3-6902M | Recombinant Mouse Pafah1b3 protein, His & T7-tagged | +Inquiry |
PAFAH1B3-3917R | Recombinant Rat PAFAH1B3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAFAH1B3-6901H | Recombinant Human PAFAH1B3 protein, His & T7-tagged | +Inquiry |
PAFAH1B3-1613H | Recombinant Human PAFAH1B3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAFAH1B3-28937TH | Recombinant Human PAFAH1B3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAFAH1B3-3467HCL | Recombinant Human PAFAH1B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAFAH1B3 Products
Required fields are marked with *
My Review for All PAFAH1B3 Products
Required fields are marked with *