Recombinant Human PAFAH1B3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PAFAH1B3-1613H
• Product Overview: PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_002564) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described.
• Molecular Mass: 25.7 kDa
• AA Sequence: MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PAFAH1B3 platelet activating factor acetylhydrolase 1b catalytic subunit 3 [ Homo sapiens (human) ]
• Official Symbol: PAFAH1B3
• Synonyms: PAFAH1B3; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD), platelet activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, platelet activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa); platelet-activating factor acetylhydrolase IB subunit gamma; PAF AH1b alpha 1 subunit; PAFAH subunit gamma; PAF-AH subunit gamma; PAF-AH 29 kDa subunit; PAF-AH1b alpha 1 subunit; PAF acetylhydrolase 29 kDa subunit; platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa); PAFAHG; FLJ44990
• Gene ID: 5050
• mRNA Refseq: NM_002573
• Protein Refseq: NP_002564
• MIM: 603074
• UniProt ID: Q15102