"PALM" Related Products

Recombinant Human PALM, His-tagged

Cat.No.: PALM-29957TH
Product Overview: Recombinant fragment, corresponding to amino acids 48-343 of Human Paralemmin isoform 2 with an N terminal His tag. Predicted MWt: 33 kDa;
Description: This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDS VSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSP AKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSP MMKAVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEA GSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATS GPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDT ITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQ AGPEATTSDPQDLDMKKHRCKCCSIM
Gene Name: PALM paralemmin [ Homo sapiens ]
Official Symbol: PALM
Synonyms: PALM; paralemmin; paralemmin-1; KIAA0270;
Gene ID: 5064
mRNA Refseq: NM_001040134
Protein Refseq: NP_001035224
MIM: 608134
Uniprot ID: O75781
Chromosome Location: 19p13.3
Function: D3 dopamine receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.