Recombinant Human PALM, His-tagged
Cat.No. : | PALM-29957TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 48-343 of Human Paralemmin isoform 2 with an N terminal His tag. Predicted MWt: 33 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 48-343 a.a. |
Description : | This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 114 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDS VSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSP AKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSP MMKAVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEA GSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATS GPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDT ITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQ AGPEATTSDPQDLDMKKHRCKCCSIM |
Gene Name | PALM paralemmin [ Homo sapiens ] |
Official Symbol | PALM |
Synonyms | PALM; paralemmin; paralemmin-1; KIAA0270; |
Gene ID | 5064 |
mRNA Refseq | NM_001040134 |
Protein Refseq | NP_001035224 |
MIM | 608134 |
Uniprot ID | O75781 |
Chromosome Location | 19p13.3 |
Function | D3 dopamine receptor binding; protein binding; |
◆ Recombinant Proteins | ||
PALM-35H | Recombinant Human PALM protein, His-tagged | +Inquiry |
PALM-4263R | Recombinant Rat PALM Protein | +Inquiry |
PALM-4012C | Recombinant Chicken PALM | +Inquiry |
PALM-3925R | Recombinant Rat PALM Protein, His (Fc)-Avi-tagged | +Inquiry |
PALM-3317H | Recombinant Human PALM protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PALM-3450HCL | Recombinant Human PALM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PALM Products
Required fields are marked with *
My Review for All PALM Products
Required fields are marked with *