Recombinant Human PARK7

• Cat.No.: PARK7-30783TH
• Product Overview: Recombinant Full Length Human PARK7/DJ1 expressed in Saccharomyces cerevisiae; amino acids 1-189; 189 amino acids, MWt 19.9 kDa. Protein is tagged with 26 kDa proprietary tag.

Specification

• Description: The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene.
• Tissue specificity: Highly expressed in pancreas, kidney, skeletal muscle, liver, testis and heart. Detected at slightly lower levels in placenta and brain. Detected in astrocytes, Sertoli cells, spermatogonia, spermatids and spermatozoa.
• Biological activity: This protein contains a proprietary tag (26 kDa) and the whole proteins MW is around 45KD.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAG KDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLG AQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHE IGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSR GPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
• Sequence Similarities: Belongs to the peptidase C56 family.

Gene Information

• Gene Name: PARK7 parkinson protein 7 [ Homo sapiens ]
• Official Symbol: PARK7
• Synonyms: PARK7; parkinson protein 7; Parkinson disease (autosomal recessive, early onset) 7; protein DJ-1; DJ 1; DJ1
• Gene ID: 11315
• mRNA Refseq: NM_001123377
• Protein Refseq: NP_001116849
• MIM: 602533
• Uniprot ID: Q99497
• Chromosome Location: 1p36.23
• Pathway: Alpha-synuclein signaling, organism-specific biosystem; Parkinsons disease, organism-specific biosystem
• Function: mRNA binding; peptidase activity; peroxidase activity; peroxiredoxin activity; protein binding