"PCDHGA2" Related Products

Recombinant Human PCDHGA2, His-tagged

Cat.No.: PCDHGA2-30552TH
Product Overview: Recombinant fragment, corresponding to amino acids 748-932 of Human PCDHGA2 with an N terminal His tag; Predicted MWt 21kDa.
Description: This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 63 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AFLQTYSHEVSLTADSRKSHLIFPQPNYADTLISQESCEK KDFLSAPQSLLEEEREETFSQQAPPNTDWRFSQAQRPG TSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGS STLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSN ATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Gene Name: PCDHGA2 protocadherin gamma subfamily A, 2 [ Homo sapiens ]
Official Symbol: PCDHGA2
Synonyms: PCDHGA2; protocadherin gamma subfamily A, 2; protocadherin gamma-A2; PCDH GAMMA A2;
Gene ID: 56113
mRNA Refseq: NM_018915
Protein Refseq: NP_061738
MIM: 606289
Uniprot ID: Q9Y5H1
Chromosome Location: 5q31
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.