Description : |
This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. |
Conjugation : |
HIS |
Source : |
E. coli |
Form : |
Lyophilised:Reconstitute with 63 μl aqua dest. |
Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
AFLQTYSHEVSLTADSRKSHLIFPQPNYADTLISQESCEK KDFLSAPQSLLEEEREETFSQQAPPNTDWRFSQAQRPG TSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGS STLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSN ATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK |