Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PCDHGA2, His-tagged

Cat.No. : PCDHGA2-30552TH
Product Overview : Recombinant fragment, corresponding to amino acids 748-932 of Human PCDHGA2 with an N terminal His tag; Predicted MWt 21kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 63 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AFLQTYSHEVSLTADSRKSHLIFPQPNYADTLISQESCEK KDFLSAPQSLLEEEREETFSQQAPPNTDWRFSQAQRPG TSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGS STLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSN ATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Gene Name : PCDHGA2 protocadherin gamma subfamily A, 2 [ Homo sapiens ]
Official Symbol : PCDHGA2
Synonyms : PCDHGA2; protocadherin gamma subfamily A, 2; protocadherin gamma-A2; PCDH GAMMA A2;
Gene ID : 56113
mRNA Refseq : NM_018915
Protein Refseq : NP_061738
MIM : 606289
Uniprot ID : Q9Y5H1
Chromosome Location : 5q31
Function : calcium ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends