Recombinant Human PCSK6

• Cat.No.: PCSK6-30177TH
• Product Overview: Recombinant fragment corresponding to amino acids 860-969 of Human PACE4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Description: The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in pla
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCR RCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNAD ETFCEMVKSNRLCERKLFIQFCCRTCLLAG
• Sequence Similarities: Belongs to the peptidase S8 family.Contains 1 homo B/P domain.Contains 1 PLAC domain.

Gene Information

• Gene Name: PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ]
• Official Symbol: PCSK6
• Synonyms: PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4
• Gene ID: 5046
• mRNA Refseq: NM_002570
• Protein Refseq: NP_002561
• MIM: 167405
• Uniprot ID: P29122
• Chromosome Location: 15q26
• Pathway: Developmental Biology, organism-specific biosystem; NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; Signalling by NGF, organism-specific biosystem
• Function: endopeptidase activity; eukaryotic cell surface binding; heparin binding; nerve growth factor binding; peptidase activity