"PDAP1" Related Products

Recombinant Human PDAP1, His-tagged

Cat.No.: PDAP1-29488TH
Product Overview: Recombinant full length Human PDAP1 with an C terminal His tag; 189 amino acids including tag, predicted MWt 21.7kDa.
Description: The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity.
Protein length: 181 amino acids
Conjugation: HIS
Molecular Weight: 21.700kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 0.1mM PMSF, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNKLEHHHHHH
Gene Name: PDAP1 PDGFA associated protein 1 [ Homo sapiens ]
Official Symbol: PDAP1
Synonyms: PDAP1; PDGFA associated protein 1; 28 kDa heat- and acid-stable phosphoprotein; HASPP28; PAP; PAP1; PDGF associated protein;
Gene ID: 11333
mRNA Refseq: NM_014891
Protein Refseq: NP_055706
MIM: 607075
Uniprot ID: Q13442
Chromosome Location: 7q

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.