"PDE2A" Related Products

Recombinant Human PDE2A

Cat.No. : PDE2A-29979TH
Product Overview : Recombinant fragment of Human PDE2A (amino acids 850-940) with a N terminal proprietary tag; Predicted MWt 35.64 kDa including the tag.
Description : cGMP-dependent 3,5-cyclic phosphodiesterase is an enzyme that in humans is encoded by the PDE2A gene.
Protein length : 91 amino acids
Molecular Weight : 35.640kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris buffered saline, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
Sequence Similarities : Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.Contains 2 GAF domains.
Gene Name : PDE2A phosphodiesterase 2A, cGMP-stimulated [ Homo sapiens ]
Official Symbol : PDE2A
Synonyms : PDE2A; phosphodiesterase 2A, cGMP-stimulated; cGMP-dependent 3,5-cyclic phosphodiesterase;
Gene ID : 5138
mRNA Refseq : NM_001143839
Protein Refseq : NP_001137311
MIM : 602658
Uniprot ID : O00408
Chromosome Location : 11q13.1-q14.1
Pathway : G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; Nitric oxide stimulates guanylate cyclase, organism-specific biosystem; Platelet homeostasis, organism-specific biosystem;
Function : 3,5-cyclic-nucleotide phosphodiesterase activity; TPR domain binding; cAMP binding; cGMP binding; cGMP binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.