Recombinant Human PDE2A
| Cat.No. : | PDE2A-29979TH | 
| Product Overview : | Recombinant fragment of Human PDE2A (amino acids 850-940) with a N terminal proprietary tag; Predicted MWt 35.64 kDa including the tag. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 91 amino acids | 
| Description : | cGMP-dependent 3,5-cyclic phosphodiesterase is an enzyme that in humans is encoded by the PDE2A gene. | 
| Molecular Weight : | 35.640kDa inclusive of tags | 
| Tissue specificity : | Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.79% Tris buffered saline, 0.3% Glutathione | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA | 
| Sequence Similarities : | Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.Contains 2 GAF domains. | 
| Gene Name | PDE2A phosphodiesterase 2A, cGMP-stimulated [ Homo sapiens ] | 
| Official Symbol | PDE2A | 
| Synonyms | PDE2A; phosphodiesterase 2A, cGMP-stimulated; cGMP-dependent 3,5-cyclic phosphodiesterase; | 
| Gene ID | 5138 | 
| mRNA Refseq | NM_001143839 | 
| Protein Refseq | NP_001137311 | 
| MIM | 602658 | 
| Uniprot ID | O00408 | 
| Chromosome Location | 11q13.1-q14.1 | 
| Pathway | G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Hemostasis, organism-specific biosystem; Nitric oxide stimulates guanylate cyclase, organism-specific biosystem; Platelet homeostasis, organism-specific biosystem; | 
| Function | 3,5-cyclic-nucleotide phosphodiesterase activity; TPR domain binding; cAMP binding; cGMP binding; cGMP binding; | 
| ◆ Recombinant Proteins | ||
| PDE2A-3347R | Recombinant Rhesus monkey PDE2A Protein, His-tagged | +Inquiry | 
| PDE2A-3815H | Recombinant Human PDE2A Protein, His (Fc)-Avi-tagged | +Inquiry | 
| PDE2A-29979TH | Recombinant Human PDE2A | +Inquiry | 
| PDE2A-07H | Recombinant Human PDE2A protein, His-tagged | +Inquiry | 
| PDE2A-0335H | Recombinant Human PDE2A Protein (G2-E941), Tag Free | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PDE2A-591HCL | Recombinant Human PDE2A cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All PDE2A Products
Required fields are marked with *
My Review for All PDE2A Products
Required fields are marked with *
  
        
    
      
            