"PDZK1" Related Products

Expand
Expand
Expand

Recombinant Human PDZK1

Cat.No.: PDZK1-30832TH
Product Overview: Recombinant full length Human PDZK1 with N terminal proprietary tag; Predicted MWt 83.2 kDa.
Description: This gene encodes a PDZ domain-containing scaffolding protein. PDZ domain-containing molecules bind to and mediate the subcellular localization of target proteins. The encoded protein mediates the localization of cell surface proteins and plays a critical role in cholesterol metabolism by regulating the HDL receptor, scavenger receptor class B type 1. Single nucleotide polymorphisms in this gene may be associated with metabolic syndrome, and overexpression of this gene may play a role in drug resistance of multiple myeloma. Pseudogenes of this gene are located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein length: 519 amino acids
Molecular Weight: 83.200kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expression is limited to epithelial cells. Expressed in the kidney (brush border of proximal tubule), pancreas, liver, and small intestine. Expressed at a lower level in the adrenal cortex, testis and stomach. Overexpressed in breast, renal and lung carci
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEK CSPAEKAGLQDGDRVLRINGVFVDKEEHMQVVDLVRKSGN SVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILS PVMNGGVQTWTQPRLCYLVKEGGSYGFSLKTVQGKKGVYM TDITPQGVAMRAGVLADDHLIEVNGENVEDASHEEVVEKV KKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQ PRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEA GLKNNDLVVAVNGESVETLDHDSVVEMIRKGGDQTSLLVV DKETDNMYRLAHFSPFLYYQSQELPNGSVKEAPAPTPTSL EVSSPPDTTEEVDHKPKLCRLAKGENGYGFHLNAIRGLPG SFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVV DRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSLADPLDT PPDSKEGIVVESNHDSHMAKERAHSTASHSSSNSEDTEM
Sequence Similarities: Belongs to the NHER family.Contains 4 PDZ (DHR) domains.
Gene Name: PDZK1 PDZ domain containing 1 [ Homo sapiens ]
Official Symbol: PDZK1
Synonyms: PDZK1; PDZ domain containing 1; Na(+)/H(+) exchange regulatory cofactor NHE-RF3; NHERF3; PDZD1;
Gene ID: 5174
mRNA Refseq: NM_001201325
Protein Refseq: NP_001188254
MIM: 603831
Uniprot ID: Q5T2W1
Chromosome Location: 1q21
Function: PDZ domain binding; protein binding; scavenger receptor binding; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.