"PGK2" Related Products

Expand

Recombinant Human PGK2

Cat.No.: PGK2-30580TH
Product Overview: Recombinant fragment of Human PGK2 with an N terminal proprietary tag; Predicted MW 33.55kDa.
Description: This gene is intronless, arose via retrotransposition of the phosphoglycerate kinase 1 gene, and is expressed specifically in the testis. Initially assumed to be a pseudogene, the encoded protein is actually a functional phosphoglycerate kinase that catalyzes the reversible conversion of 1,3-bisphosphoglycerate to 3-phosphoglycerate, during the Embden-Meyerhof-Parnas pathway of glycolysis, in the later stages of spermatogenesis.
Protein length: 72 amino acids
Molecular Weight: 33.550kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Testis specific.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP
Sequence Similarities: Belongs to the phosphoglycerate kinase family.
Gene Name: PGK2 phosphoglycerate kinase 2 [ Homo sapiens ]
Official Symbol: PGK2
Synonyms: PGK2; phosphoglycerate kinase 2; PGK 2; PGKPS;
Gene ID: 5232
mRNA Refseq: NM_138733
Protein Refseq: NP_620061
MIM: 172270
Uniprot ID: P07205
Chromosome Location: 6p21-q12
Pathway: Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; Glycolysis (Embden-Meyerhof pathway), glucose =>
Function: ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.