Recombinant Human PGK2
Cat.No. : | PGK2-30580TH |
Product Overview : | Recombinant fragment of Human PGK2 with an N terminal proprietary tag; Predicted MW 33.55kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 72 amino acids |
Description : | This gene is intronless, arose via retrotransposition of the phosphoglycerate kinase 1 gene, and is expressed specifically in the testis. Initially assumed to be a pseudogene, the encoded protein is actually a functional phosphoglycerate kinase that catalyzes the reversible conversion of 1,3-bisphosphoglycerate to 3-phosphoglycerate, during the Embden-Meyerhof-Parnas pathway of glycolysis, in the later stages of spermatogenesis. |
Molecular Weight : | 33.550kDa inclusive of tags |
Tissue specificity : | Testis specific. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP |
Sequence Similarities : | Belongs to the phosphoglycerate kinase family. |
Gene Name | PGK2 phosphoglycerate kinase 2 [ Homo sapiens ] |
Official Symbol | PGK2 |
Synonyms | PGK2; phosphoglycerate kinase 2; PGK 2; PGKPS; |
Gene ID | 5232 |
mRNA Refseq | NM_138733 |
Protein Refseq | NP_620061 |
MIM | 172270 |
Uniprot ID | P07205 |
Chromosome Location | 6p21-q12 |
Pathway | Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; Glycolysis (Embden-Meyerhof pathway), glucose => |
Function | ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity; |
◆ Recombinant Proteins | ||
PGK2-4334H | Recombinant Human PGK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PGK2-334H | Recombinant Human PGK2 | +Inquiry |
PGK2-361H | Recombinant Human PGK2, His-tagged | +Inquiry |
PGK2-530C | Recombinant Cynomolgus Monkey PGK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGK2-1666H | Recombinant Human PGK2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGK2-3256HCL | Recombinant Human PGK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGK2 Products
Required fields are marked with *
My Review for All PGK2 Products
Required fields are marked with *
0
Inquiry Basket