Recombinant Human PGK2
| Cat.No. : | PGK2-30580TH |
| Product Overview : | Recombinant fragment of Human PGK2 with an N terminal proprietary tag; Predicted MW 33.55kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 72 amino acids |
| Description : | This gene is intronless, arose via retrotransposition of the phosphoglycerate kinase 1 gene, and is expressed specifically in the testis. Initially assumed to be a pseudogene, the encoded protein is actually a functional phosphoglycerate kinase that catalyzes the reversible conversion of 1,3-bisphosphoglycerate to 3-phosphoglycerate, during the Embden-Meyerhof-Parnas pathway of glycolysis, in the later stages of spermatogenesis. |
| Molecular Weight : | 33.550kDa inclusive of tags |
| Tissue specificity : | Testis specific. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP |
| Sequence Similarities : | Belongs to the phosphoglycerate kinase family. |
| Gene Name | PGK2 phosphoglycerate kinase 2 [ Homo sapiens ] |
| Official Symbol | PGK2 |
| Synonyms | PGK2; phosphoglycerate kinase 2; PGK 2; PGKPS; |
| Gene ID | 5232 |
| mRNA Refseq | NM_138733 |
| Protein Refseq | NP_620061 |
| MIM | 172270 |
| Uniprot ID | P07205 |
| Chromosome Location | 6p21-q12 |
| Pathway | Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; Glycolysis (Embden-Meyerhof pathway), glucose => |
| Function | ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| PGK2-30580TH | Recombinant Human PGK2 | +Inquiry |
| PGK2-334H | Recombinant Human PGK2 | +Inquiry |
| PGK2-786C | Recombinant Cynomolgus PGK2 Protein, His-tagged | +Inquiry |
| PGK2-4334H | Recombinant Human PGK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PGK2-981H | Recombinant Human Phosphoglycerate Kinase 2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGK2-3256HCL | Recombinant Human PGK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGK2 Products
Required fields are marked with *
My Review for All PGK2 Products
Required fields are marked with *
