Recombinant Human PGK2

• Cat.No.: PGK2-30580TH
• Product Overview: Recombinant fragment of Human PGK2 with an N terminal proprietary tag; Predicted MW 33.55kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 72 amino acids
• Description: This gene is intronless, arose via retrotransposition of the phosphoglycerate kinase 1 gene, and is expressed specifically in the testis. Initially assumed to be a pseudogene, the encoded protein is actually a functional phosphoglycerate kinase that catalyzes the reversible conversion of 1,3-bisphosphoglycerate to 3-phosphoglycerate, during the Embden-Meyerhof-Parnas pathway of glycolysis, in the later stages of spermatogenesis.
• Molecular Weight: 33.550kDa inclusive of tags
• Tissue specificity: Testis specific.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP
• Sequence Similarities: Belongs to the phosphoglycerate kinase family.

Gene Information

• Gene Name: PGK2 phosphoglycerate kinase 2 [ Homo sapiens ]
• Official Symbol: PGK2
• Synonyms: PGK2; phosphoglycerate kinase 2; PGK 2; PGKPS
• Gene ID: 5232
• mRNA Refseq: NM_138733
• Protein Refseq: NP_620061
• MIM: 172270
• Uniprot ID: P07205
• Chromosome Location: 6p21-q12
• Pathway: Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; Glycolysis (Embden-Meyerhof pathway), glucose =>
• Function: ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity