"PHRF1" Related Products

Recombinant Human PHRF1, His-tagged

Cat.No.: PHRF1-29585TH
Product Overview: Recombinant fragment, corresponding to amino acids 1328-1649 of Human PHRF1 with N terminal His tag; Predicted MWt 36 kDa.
Description: PHRF1 contains 1 PHD-type zinc finger and 1 RING-type zinc finger. It may interact with POLR2A (via the C-terminal domain).
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 155 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DEDPSQPPPLPEGTQEPHLLRPDAAEKAEAPSSPDVAPAG KEDSPSASGRVQEAARPEEVVSQTPLLRSRALVKRVTW NLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAP TGVRQAFSELPFPSHVLPEPGFPDTDPSQVYSPGLPPA PAQPSSIPPCALVSQPTVQFILQGSLPLVGCGAAQTLAPV PAALTPASEPASQATAASNSEEKTPAPRLAAEKTKKEE YMKKLHMQERAVEEVKLAIKPFYQKREVTKEEYKDILR KAVQKICHSKSGEINPVKVANLVKAYVDKYRHMRRHKK PEAGEEPPTQGAEG
Gene Name: PHRF1 PHD and ring finger domains 1 [ Homo sapiens ]
Official Symbol: PHRF1
Synonyms: PHRF1; PHD and ring finger domains 1; RNF221; PHD and RING finger domain-containing protein 1; CTD binding SR like protein rA9; KIAA1542;
Gene ID: 57661
mRNA Refseq: NM_020901
Protein Refseq: NP_065952
MIM: 611780
Uniprot ID: Q9P1Y6
Chromosome Location: 11p15.5
Function: RNA polymerase binding; metal ion binding; protein domain specific binding; zinc ion binding;
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.