"PITRM1" Related Products

Expand

Recombinant Human PITRM1, His-tagged

Cat.No.: PITRM1-27541TH
Product Overview: Recombinant fragment, corresponding to amino acids 364-1037 of Human PITRM1 with N terminal His tag; MWt 80 kDa.
Description: Presequence protease, mitochondrial is an enzyme that in humans is encoded by the PITRM1 gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed. Expressed at higher level in muscle and heart compared to brain, pancreas, liver, lung and placenta.
Form: Lyophilised:Reconstitute with 58 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ALIESGLGTDFSPDVGYNGYTREAYFSVGLQGIAEKDIET VRSLIDRTIDEVVEKGFEDDRIEALLHKIEIQMKHQST SFGLMLTSYIASCWNHDGDPVELLKLGNQLAKFRQCLQ ENPKFLQEKVKQYFKNNQHKLTLSMRPDDKYHEKQAQVEA TKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCL PALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGM VYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCL DRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKMTAQELA NGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLM KRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQM PQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSG GDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNY VGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAK SGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGL SDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLA ILGPENPKIAKDPSWIIQ
Sequence Similarities: Belongs to the peptidase M16 family. PreP subfamily.
Gene Name: PITRM1 pitrilysin metallopeptidase 1 [ Homo sapiens ]
Official Symbol: PITRM1
Synonyms: PITRM1; pitrilysin metallopeptidase 1; pitrilysin metalloproteinase 1; presequence protease, mitochondrial; hMP1; KIAA1104; MP1; PreP; PreP peptidasome;
Gene ID: 10531
mRNA Refseq: NM_001242307
Protein Refseq: NP_001229236
Uniprot ID: Q5JRX3
Chromosome Location: 10p15.2
Function: enzyme activator activity; metal ion binding; metalloendopeptidase activity; peptidase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.