Recombinant Human PITX1

Cat.No. : PITX1-29536TH
Product Overview : Recombinant fragment of Human PITX1 with an N terminal proprietary tag; Predicted MW 35.42kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 89 amino acids
Description : This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.
Molecular Weight : 35.420kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGALQGPASGLNACQYN
Sequence Similarities : Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name PITX1 paired-like homeodomain 1 [ Homo sapiens ]
Official Symbol PITX1
Synonyms PITX1; paired-like homeodomain 1; BFT, paired like homeodomain transcription factor 1; pituitary homeobox 1; POTX; PTX1;
Gene ID 5307
mRNA Refseq NM_002653
Protein Refseq NP_002644
MIM 602149
Uniprot ID P78337
Chromosome Location 5q31.1
Function protein binding transcription factor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PITX1 Products

Required fields are marked with *

My Review for All PITX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon