"PITX1" Related Products

Expand

Recombinant Human PITX1

Cat.No.: PITX1-29536TH
Product Overview: Recombinant fragment of Human PITX1 with an N terminal proprietary tag; Predicted MW 35.42kDa.
Description: This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.
Protein length: 89 amino acids
Molecular Weight: 35.420kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGALQGPASGLNACQYN
Sequence Similarities: Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name: PITX1 paired-like homeodomain 1 [ Homo sapiens ]
Official Symbol: PITX1
Synonyms: PITX1; paired-like homeodomain 1; BFT, paired like homeodomain transcription factor 1; pituitary homeobox 1; POTX; PTX1;
Gene ID: 5307
mRNA Refseq: NM_002653
Protein Refseq: NP_002644
MIM: 602149
Uniprot ID: P78337
Chromosome Location: 5q31.1
Function: protein binding transcription factor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.