Recombinant Human PITX1
Cat.No. : | PITX1-29536TH |
Product Overview : | Recombinant fragment of Human PITX1 with an N terminal proprietary tag; Predicted MW 35.42kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Description : | This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. |
Molecular Weight : | 35.420kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGALQGPASGLNACQYN |
Sequence Similarities : | Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain. |
Gene Name | PITX1 paired-like homeodomain 1 [ Homo sapiens ] |
Official Symbol | PITX1 |
Synonyms | PITX1; paired-like homeodomain 1; BFT, paired like homeodomain transcription factor 1; pituitary homeobox 1; POTX; PTX1; |
Gene ID | 5307 |
mRNA Refseq | NM_002653 |
Protein Refseq | NP_002644 |
MIM | 602149 |
Uniprot ID | P78337 |
Chromosome Location | 5q31.1 |
Function | protein binding transcription factor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
Pitx1-4865M | Recombinant Mouse Pitx1 protein, Avi-tagged, Biotinylated | +Inquiry |
PITX1-4476R | Recombinant Rat PITX1 Protein | +Inquiry |
PITX1-4136R | Recombinant Rat PITX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PITX1-12849M | Recombinant Mouse PITX1 Protein | +Inquiry |
PITX1-29536TH | Recombinant Human PITX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PITX1-1358HCL | Recombinant Human PITX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PITX1 Products
Required fields are marked with *
My Review for All PITX1 Products
Required fields are marked with *