Recombinant Full Length Human PITX1 Protein
Cat.No. : | PITX1-372HF |
Product Overview : | Recombinant full length Human PITX1 with N terminal proprietary tag; Predicted MW 60.61kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 314 amino acids |
Description : | This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. |
Form : | Liquid |
Molecular Mass : | 60.610kDa inclusive of tags |
AA Sequence : | MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPR EPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGA DDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE EIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGY VPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFT FFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNS SLASLRLKSKQHSSFGYGALQGPASGLNACQYNS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PITX1 paired-like homeodomain 1 [ Homo sapiens ] |
Official Symbol | PITX1 |
Synonyms | PITX1; paired-like homeodomain 1; BFT, paired like homeodomain transcription factor 1; pituitary homeobox 1; POTX; PTX1 |
Gene ID | 5307 |
mRNA Refseq | NM_002653 |
Protein Refseq | NP_002644 |
MIM | 602149 |
UniProt ID | P78337 |
◆ Recombinant Proteins | ||
Pitx1-4863M | Recombinant Mouse Pitx1 protein | +Inquiry |
PITX1-4009C | Recombinant Chicken PITX1 | +Inquiry |
Pitx1-4864M | Recombinant Mouse Pitx1 protein | +Inquiry |
Pitx1-4865M | Recombinant Mouse Pitx1 protein, Avi-tagged, Biotinylated | +Inquiry |
PITX1-4136R | Recombinant Rat PITX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PITX1-1358HCL | Recombinant Human PITX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PITX1 Products
Required fields are marked with *
My Review for All PITX1 Products
Required fields are marked with *
0
Inquiry Basket