"PKD2" Related Products

Expand
Expand
Expand

Recombinant Human PKD2

Cat.No.: PKD2-30689TH
Product Overview: Recombinant fragment of Human Polycystin 2 with N terminal proprietary tag; predicted MWt: 36.63 kDa including the tag.
Description: This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Strongly expressed in ovary, fetal and adult kidney, testis, and small intestine. Not detected in peripheral leukocytes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
Sequence Similarities: Belongs to the polycystin family.Contains 1 EF-hand domain.
Gene Name: PKD2 polycystic kidney disease 2 (autosomal dominant) [ Homo sapiens ]
Official Symbol: PKD2
Synonyms: PKD2; polycystic kidney disease 2 (autosomal dominant); polycystin-2; Pc 2; PC2; PKD4; transient receptor potential cation channel; subfamily P; member 2; TRPP2;
Gene ID: 5311
mRNA Refseq: NM_000297
Protein Refseq: NP_000288
MIM: 173910
Uniprot ID: Q13563
Chromosome Location: 4q22.1
Function: ATPase binding; calcium ion binding; channel activity; cytoskeletal protein binding; ion channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.