Recombinant Human PKD2

• Cat.No.: PKD2-30689TH
• Product Overview: Recombinant fragment of Human Polycystin 2 with N terminal proprietary tag; predicted MWt: 36.63 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Strongly expressed in ovary, fetal and adult kidney, testis, and small intestine. Not detected in peripheral leukocytes.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
• Sequence Similarities: Belongs to the polycystin family.Contains 1 EF-hand domain.

Gene Information

• Gene Name: PKD2 polycystic kidney disease 2 (autosomal dominant) [ Homo sapiens ]
• Official Symbol: PKD2
• Synonyms: PKD2; polycystic kidney disease 2 (autosomal dominant); polycystin-2; Pc 2; PC2; PKD4; transient receptor potential cation channel; subfamily P; member 2; TRPP2
• Gene ID: 5311
• mRNA Refseq: NM_000297
• Protein Refseq: NP_000288
• MIM: 173910
• Uniprot ID: Q13563
• Chromosome Location: 4q22.1
• Function: ATPase binding; calcium ion binding; channel activity; cytoskeletal protein binding; ion channel activity