Recombinant Human PKD2 Protein, GST-tagged
| Cat.No. : | PKD2-19H |
| Product Overview : | Recombinant Human PKD2 Protein(682-923 aa), fused to GST tag, was expressed in E. coli. |
| Availability | November 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 682-923 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | DTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAAS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PKD2 polycystic kidney disease 2 (autosomal dominant) [ Homo sapiens ] |
| Official Symbol | PKD2 |
| Synonyms | PKD2; polycystic kidney disease 2 (autosomal dominant); polycystin-2; Pc 2; PC2; PKD4; transient receptor potential cation channel; subfamily P; member 2; TRPP2; R48321; polycystwin; autosomal dominant polycystic kidney disease type II protein; transient receptor potential cation channel, subfamily P, member 2; Pc-2; APKD2; MGC138466; MGC138468; |
| Gene ID | 5311 |
| mRNA Refseq | NM_000297 |
| Protein Refseq | NP_000288 |
| MIM | 173910 |
| UniProt ID | Q13563 |
| ◆ Recombinant Proteins | ||
| PKD2-459Z | Recombinant Zebrafish PKD2 | +Inquiry |
| PKD2-19H | Recombinant Human PKD2 Protein, GST-tagged | +Inquiry |
| PKD2-12860M | Recombinant Mouse PKD2 Protein | +Inquiry |
| PKD2-410H | Recombinant Human PKD2, GST-tagged, Active | +Inquiry |
| PKD2-30689TH | Recombinant Human PKD2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PKD2 Products
Required fields are marked with *
My Review for All PKD2 Products
Required fields are marked with *
