Recombinant Human PKD2 Protein, GST-tagged

• Cat.No.: PKD2-19H
• Product Overview: Recombinant Human PKD2 Protein(682-923 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 682-923 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: DTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAAS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PKD2 polycystic kidney disease 2 (autosomal dominant) [ Homo sapiens ]
• Official Symbol: PKD2
• Synonyms: PKD2; polycystic kidney disease 2 (autosomal dominant); polycystin-2; Pc 2; PC2; PKD4; transient receptor potential cation channel; subfamily P; member 2; TRPP2; R48321; polycystwin; autosomal dominant polycystic kidney disease type II protein; transient receptor potential cation channel, subfamily P, member 2; Pc-2; APKD2; MGC138466; MGC138468
• Gene ID: 5311
• mRNA Refseq: NM_000297
• Protein Refseq: NP_000288
• MIM: 173910
• UniProt ID: Q13563