"PLCB3" Related Products

Recombinant Human PLCB3, His-tagged

Cat.No.: PLCB3-27922TH
Product Overview: Recombinant fragment, corresponding to amino acids 1021-1234 of Human Phospholipase C beta 3 with an N terminal His tag. Predicted MWt: 26 kDa;
Description: This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1,4,5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 165 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEH LRQALQRLREVVLDANTTQFKRLKEMNEREKKELQKIL DRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSI RRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQEC QEQRARLPQEIRRSLLGEMPEGLGDGPLVACASNGHAP GSSGHLSGADSESQEENTQL
Gene Name: PLCB3 phospholipase C, beta 3 (phosphatidylinositol-specific) [ Homo sapiens ]
Official Symbol: PLCB3
Synonyms: PLCB3; phospholipase C, beta 3 (phosphatidylinositol-specific); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3;
Gene ID: 5331
mRNA Refseq: NM_000932
Protein Refseq: NP_000923
MIM: 600230
Uniprot ID: Q01970
Chromosome Location: 11q13
Pathway: Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem;
Function: calcium ion binding; calmodulin binding; hydrolase activity; phosphatidylinositol phospholipase C activity; phospholipase C activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.