"PLD3" Related Products

Expand
Expand
Expand

Recombinant Human PLD3, His-tagged

Cat.No.: PLD3-30088TH
Product Overview: Recombinant fragment, corresponding to amino acids 252-490 of Human PLD3 with an N-terminal His Tag, MWt approximately 31kDa.
Description: PLD3 belongs to the phospholipase D family. It contains two PLD phosphodiesterase domains. PLD3 is widely expressed; expressed at higher level in brain; low level in corpus callosum, suggsting that it is highly expressed in neurons. PLD3 has a post-translational modification, it is glycosylated.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 56 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: WFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAY LASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNY LPTLEFSHPHRFWPAIDDGLRRATYERGVKVRLLISCW GHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQA RIPYARVNHNKYMVTERATYIGTSNWSGNYFTETAGTS LLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSV GNACRLL
Gene Name: PLD3 phospholipase D family, member 3 [ Homo sapiens ]
Official Symbol: PLD3
Synonyms: PLD3; phospholipase D family, member 3; phospholipase D3; HU K4;
Gene ID: 23646
mRNA Refseq: NM_001031696
Protein Refseq: NP_001026866
Uniprot ID: Q8IV08
Chromosome Location: 19q13.2
Function: NAPE-specific phospholipase D activity; hydrolase activity; phospholipase D activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.