Recombinant Human PLD3, His-tagged
Cat.No. : | PLD3-30088TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 252-490 of Human PLD3 with an N-terminal His Tag, MWt approximately 31kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 252-490 a.a. |
Description : | PLD3 belongs to the phospholipase D family. It contains two PLD phosphodiesterase domains. PLD3 is widely expressed; expressed at higher level in brain; low level in corpus callosum, suggsting that it is highly expressed in neurons. PLD3 has a post-translational modification, it is glycosylated. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 56 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAY LASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNY LPTLEFSHPHRFWPAIDDGLRRATYERGVKVRLLISCW GHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQA RIPYARVNHNKYMVTERATYIGTSNWSGNYFTETAGTS LLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSV GNACRLL |
Gene Name | PLD3 phospholipase D family, member 3 [ Homo sapiens ] |
Official Symbol | PLD3 |
Synonyms | PLD3; phospholipase D family, member 3; phospholipase D3; HU K4; |
Gene ID | 23646 |
mRNA Refseq | NM_001031696 |
Protein Refseq | NP_001026866 |
Uniprot ID | Q8IV08 |
Chromosome Location | 19q13.2 |
Function | NAPE-specific phospholipase D activity; hydrolase activity; phospholipase D activity; protein binding; |
◆ Recombinant Proteins | ||
RFL12565MF | Recombinant Full Length Mouse Phospholipase D3(Pld3) Protein, His-Tagged | +Inquiry |
Pld3-2388M | Recombinant Mouse Pld3 Full Length Transmembrane protein, His-tagged | +Inquiry |
PLD3-105H | Recombinant Human PLD3, GST-tagged | +Inquiry |
PLD3-6824M | Recombinant Mouse PLD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLD3-4171R | Recombinant Rat PLD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLD3-3122HCL | Recombinant Human PLD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLD3 Products
Required fields are marked with *
My Review for All PLD3 Products
Required fields are marked with *