Recombinant Human PLD3, His-tagged
Cat.No. : | PLD3-30088TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 252-490 of Human PLD3 with an N-terminal His Tag, MWt approximately 31kDa. |
- Specification
- Gene Information
- Related Products
Description : | PLD3 belongs to the phospholipase D family. It contains two PLD phosphodiesterase domains. PLD3 is widely expressed; expressed at higher level in brain; low level in corpus callosum, suggsting that it is highly expressed in neurons. PLD3 has a post-translational modification, it is glycosylated. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 56 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAY LASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNY LPTLEFSHPHRFWPAIDDGLRRATYERGVKVRLLISCW GHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQA RIPYARVNHNKYMVTERATYIGTSNWSGNYFTETAGTS LLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSV GNACRLL |
Gene Name : | PLD3 phospholipase D family, member 3 [ Homo sapiens ] |
Official Symbol : | PLD3 |
Synonyms : | PLD3; phospholipase D family, member 3; phospholipase D3; HU K4; |
Gene ID : | 23646 |
mRNA Refseq : | NM_001031696 |
Protein Refseq : | NP_001026866 |
Uniprot ID : | Q8IV08 |
Chromosome Location : | 19q13.2 |
Function : | NAPE-specific phospholipase D activity; hydrolase activity; phospholipase D activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
PLD3-3283R | Recombinant Rhesus Macaque PLD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLD3-4171R | Recombinant Rat PLD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLD3-6824M | Recombinant Mouse PLD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pld3-4922M | Recombinant Mouse Pld3 Protein, Myc/DDK-tagged | +Inquiry |
PLD3-3465R | Recombinant Rhesus monkey PLD3 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
PLD3-3122HCL | Recombinant Human PLD3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket