Recombinant Human PLGLB2
| Cat.No. : | PLGLB2-30883TH |
| Product Overview : | Recombinant full length Human PLGLB2 expressed in Saccharomyces cerevisiae, amino acids 1-96, Predicted MWt 11 kDa. 25 kDa proprietary tag is attached. |
- Specification
- Gene Information
- Related Products
| Description : | Plasminogen-related protein B is a protein that in humans is encoded by the PLGLB2 gene. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQ LGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAE NRKSSIIIRMRDAVLFEK |
| Gene Name : | PLGLB2 plasminogen-like B2 [ Homo sapiens ] |
| Official Symbol : | PLGLB2 |
| Synonyms : | PLGLB2; plasminogen-like B2; plasminogen pseudogene 1 , PLGP1; plasminogen-related protein B; |
| Gene ID : | 5342 |
| mRNA Refseq : | NM_002665 |
| Protein Refseq : | NP_002656 |
| Uniprot ID : | Q02325 |
| Chromosome Location : | 2p11.2 |
Products Types
| ◆ Recombinant Protein | ||
| PLGLB2-1787H | Recombinant Human PLGLB2, His-tagged | +Inquiry |
| ◆ Lysates | ||
| PLGLB2-3108HCL | Recombinant Human PLGLB2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
