Recombinant Human PLGLB2
| Cat.No. : | PLGLB2-30883TH |
| Product Overview : | Recombinant full length Human PLGLB2 expressed in Saccharomyces cerevisiae, amino acids 1-96, Predicted MWt 11 kDa. 25 kDa proprietary tag is attached. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Protein Length : | 1-96 a.a. |
| Description : | Plasminogen-related protein B is a protein that in humans is encoded by the PLGLB2 gene. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQ LGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAE NRKSSIIIRMRDAVLFEK |
| Full Length : | Full L. |
| Gene Name | PLGLB2 plasminogen-like B2 [ Homo sapiens ] |
| Official Symbol | PLGLB2 |
| Synonyms | PLGLB2; plasminogen-like B2; plasminogen pseudogene 1 , PLGP1; plasminogen-related protein B; |
| Gene ID | 5342 |
| mRNA Refseq | NM_002665 |
| Protein Refseq | NP_002656 |
| Uniprot ID | Q02325 |
| Chromosome Location | 2p11.2 |
| ◆ Recombinant Proteins | ||
| PLGLB2-30883TH | Recombinant Human PLGLB2 | +Inquiry |
| PLGLB2-1787H | Recombinant Human PLGLB2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLGLB2-3108HCL | Recombinant Human PLGLB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLGLB2 Products
Required fields are marked with *
My Review for All PLGLB2 Products
Required fields are marked with *
