"PLXNA2" Related Products

Expand

Recombinant Human PLXNA2

Cat.No.: PLXNA2-30876TH
Product Overview: Recombinant fragment Human Plexin A2 with N-terminal proprietary tag. Predicted MW 44.15kDa.
Description: This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C.
Protein length: 165 amino acids
Molecular Weight: 44.150kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Detected in fetal brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDAC LSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSW VERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSAL NEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAM SIES
Sequence Similarities: Belongs to the plexin family.Contains 4 IPT/TIG domains.Contains 1 Sema domain.
Gene Name: PLXNA2 plexin A2 [ Homo sapiens ]
Official Symbol: PLXNA2
Synonyms: PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT;
Gene ID: 5362
mRNA Refseq: NM_025179
Protein Refseq: NP_079455
MIM: 601054
Uniprot ID: O75051
Chromosome Location: 1q32.2
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; CRMPs in Sema3A signaling, organism-specific biosystem;
Function: receptor activity; semaphorin receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.