Recombinant Human PLXNA2

• Cat.No.: PLXNA2-30876TH
• Product Overview: Recombinant fragment Human Plexin A2 with N-terminal proprietary tag. Predicted MW 44.15kDa.

Specification

• Description: This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C.
• Protein length: 165 amino acids
• Molecular Weight: 44.150kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Detected in fetal brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDAC LSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSW VERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSAL NEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAM SIES
• Sequence Similarities: Belongs to the plexin family.Contains 4 IPT/TIG domains.Contains 1 Sema domain.

Gene Information

• Gene Name: PLXNA2 plexin A2 [ Homo sapiens ]
• Official Symbol: PLXNA2
• Synonyms: PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT
• Gene ID: 5362
• mRNA Refseq: NM_025179
• Protein Refseq: NP_079455
• MIM: 601054
• Uniprot ID: O75051
• Chromosome Location: 1q32.2
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; CRMPs in Sema3A signaling, organism-specific biosystem
• Function: receptor activity; semaphorin receptor activity