Recombinant Human PLXNA2 protein(Thr861- Val1220), SUMO &His-tagged
Cat.No. : | PLXNA2-21H |
Product Overview : | Recombinant Human PLXNA2 protein(Thr861- Val1220)(O75051), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | Thr861- Val1220 |
Form : | 0.15 M Phosphate buffered saline, pH 7.4. |
Molecular Mass : | 52.5 kDa |
Storage : | Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVPCTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMSEIVCVSPPSSNGLGPVPVSVSVDRAHVDSNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMV |
Gene Name | PLXNA2 plexin A2 [ Homo sapiens ] |
Official Symbol | PLXNA2 |
Synonyms | PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT; |
Gene ID | 5362 |
mRNA Refseq | NM_025179 |
Protein Refseq | NP_079455 |
MIM | 601054 |
UniProt ID | O75051 |
◆ Recombinant Proteins | ||
PLXNA2-21H | Recombinant Human PLXNA2 protein(Thr861- Val1220), SUMO &His-tagged | +Inquiry |
PLXNA2-30876TH | Recombinant Human PLXNA2 | +Inquiry |
PLXNA2-12999M | Recombinant Mouse PLXNA2 Protein | +Inquiry |
PLXNA2-6865M | Recombinant Mouse PLXNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLXNA2-001H | Recombinant Human plexin A2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLXNA2 Products
Required fields are marked with *
My Review for All PLXNA2 Products
Required fields are marked with *
0
Inquiry Basket