Recombinant Human PLXNA2 protein(Thr861- Val1220), SUMO &His-tagged

Cat.No. : PLXNA2-21H
Product Overview : Recombinant Human PLXNA2 protein(Thr861- Val1220)(O75051), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : Thr861- Val1220
Form : 0.15 M Phosphate buffered saline, pH 7.4.
Molecular Mass : 52.5 kDa
Storage : Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVPCTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMSEIVCVSPPSSNGLGPVPVSVSVDRAHVDSNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMV
Gene Name PLXNA2 plexin A2 [ Homo sapiens ]
Official Symbol PLXNA2
Synonyms PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT;
Gene ID 5362
mRNA Refseq NM_025179
Protein Refseq NP_079455
MIM 601054
UniProt ID O75051

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLXNA2 Products

Required fields are marked with *

My Review for All PLXNA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon