Recombinant Human POLD1, His-tagged

• Cat.No.: POLD1-28360TH
• Product Overview: Recombinant fragment, corresponding to amino acids 929-1102 of Human DNA Polymerase delta, catalytic subunit with an N terminal His tag. Predicted MWt: 21 kDa

Specification

• Description: The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1, POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (MIM 611525) (Liu and Warbrick, 2006
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 89 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQLAKPLLR IFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFA KRRNCCIGCRTVLSHQGAVCEFCQPRESELYQKEVSHL NALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMR KKVRKDLEDQEQLLRRFGPP
• Sequence Similarities: Belongs to the DNA polymerase type-B family.

Gene Information

• Gene Name: POLD1 polymerase (DNA directed), delta 1, catalytic subunit 125kDa [ Homo sapiens ]
• Official Symbol: POLD1
• Synonyms: POLD1; polymerase (DNA directed), delta 1, catalytic subunit 125kDa; POLD, polymerase (DNA directed), delta 1, catalytic subunit (125kD); DNA polymerase delta catalytic subunit; CDC2; CDC2 homolog (S. cerevisiae)
• Gene ID: 5424
• mRNA Refseq: NM_002691
• Protein Refseq: NP_002682
• MIM: 174761
• Uniprot ID: P28340
• Chromosome Location: 19q13.3
• Pathway: Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem
• Function: 3-5-exodeoxyribonuclease activity; DNA binding; DNA-directed DNA polymerase activity; chromatin binding; hydrolase activity