Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PPIL1, His-tagged

Cat.No. : PPIL1-29971TH
Product Overview : Recombinant full length human PPIL1, fused to His tag at C terminus; 174 amino acids, 19.3 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Conjugation : HIS
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFA ELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSGLEHHHHHH
Gene Name : PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ]
Official Symbol : PPIL1
Synonyms : PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1;
Gene ID : 51645
mRNA Refseq : NM_016059
Protein Refseq : NP_057143
MIM : 601301
Uniprot ID : Q9Y3C6
Chromosome Location : 6p21.1
Pathway : Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem;
Function : isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PPIL1 Products

Required fields are marked with *

My Review for All PPIL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends