"PPIL1" Related Products

Expand
Expand

Recombinant Human PPIL1, His-tagged

Cat.No.: PPIL1-29971TH
Product Overview: Recombinant full length human PPIL1, fused to His tag at C terminus; 174 amino acids, 19.3 kDa.
Description: This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Conjugation: HIS
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFA ELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSGLEHHHHHH
Gene Name: PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ]
Official Symbol: PPIL1
Synonyms: PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1;
Gene ID: 51645
mRNA Refseq: NM_016059
Protein Refseq: NP_057143
MIM: 601301
Uniprot ID: Q9Y3C6
Chromosome Location: 6p21.1
Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem;
Function: isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.