Recombinant Human PPIL1, His-tagged
Cat.No. : | PPIL1-29971TH |
Product Overview : | Recombinant full length human PPIL1, fused to His tag at C terminus; 174 amino acids, 19.3 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFA ELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSGLEHHHHHH |
Gene Name : | PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ] |
Official Symbol : | PPIL1 |
Synonyms : | PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1; |
Gene ID : | 51645 |
mRNA Refseq : | NM_016059 |
Protein Refseq : | NP_057143 |
MIM : | 601301 |
Uniprot ID : | Q9Y3C6 |
Chromosome Location : | 6p21.1 |
Pathway : | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; |
Function : | isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
Products Types
◆ Recombinant Protein | ||
PPIL1-410H | Recombinant Human PPIL1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPIL1-8641H | Recombinant Human PPIL1 protein, His-tagged | +Inquiry |
PPIL1-177H | Recombinant Human PPIL1 protein, T7-tagged | +Inquiry |
PPIL1-333H | Recombinant Human Peptidylprolyl Isomerase (Cyclophilin)-Like 1, His-tagged | +Inquiry |
PPIL1-3435Z | Recombinant Zebrafish PPIL1 | +Inquiry |
◆ Lysates | ||
PPIL1-2968HCL | Recombinant Human PPIL1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All PPIL1 Products
Required fields are marked with *
My Review for All PPIL1 Products
Required fields are marked with *
0
Inquiry Basket