"PPP1CC" Related Products

Expand
Expand

Recombinant Human PPP1CC

Cat.No.: PPP1CC-29101TH
Product Overview: Recombinant full length Human PP1C gamma with N-terminal proprietary tag.Mol Wt 61.27 kDa inclusive of tag.
Description: The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length: 323 amino acids
Molecular Weight: 61.270kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCL KSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL LCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ AKK
Sequence Similarities: Belongs to the PPP phosphatase family. PP-1 subfamily.
Gene Name: PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ]
Official Symbol: PPP1CC
Synonyms: PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma;
Gene ID: 5501
mRNA Refseq: NM_001244974
Protein Refseq: NP_001231903
MIM: 176914
Uniprot ID: P36873
Chromosome Location: 12q24.1-q24.2
Pathway: Aurora B signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem;
Function: hydrolase activity; metal ion binding; protein binding; protein kinase binding; protein serine/threonine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.