Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PPP2CB

Cat.No. : PPP2CB-27931TH
Product Overview : Recombinant full length Human PPP2CB withan N terminal proprietary tag; Predicted MWt 59.73 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit.
Protein length : 309 amino acids
Molecular Weight : 59.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILT KESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNY LFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD GQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW SDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Sequence Similarities : Belongs to the PPP phosphatase family. PP-1 subfamily.
Gene Name : PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ]
Official Symbol : PPP2CB
Synonyms : PPP2CB; protein phosphatase 2, catalytic subunit, beta isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; PP2Abeta; protein phosphatase 2A catalytic subuni
Gene ID : 5516
mRNA Refseq : NM_001009552
Protein Refseq : NP_001009552
MIM : 176916
Uniprot ID : P62714
Chromosome Location : 8p12
Pathway : Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function : hydrolase activity; metal ion binding; protein C-terminus binding; protein binding; contributes_to protein serine/threonine phosphatase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PPP2CB Products

Required fields are marked with *

My Review for All PPP2CB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends