"PPP2CB" Related Products

Expand
Expand

Recombinant Human PPP2CB

Cat.No.: PPP2CB-27931TH
Product Overview: Recombinant full length Human PPP2CB withan N terminal proprietary tag; Predicted MWt 59.73 kDa.
Description: This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit.
Protein length: 309 amino acids
Molecular Weight: 59.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILT KESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNY LFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD GQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW SDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Sequence Similarities: Belongs to the PPP phosphatase family. PP-1 subfamily.
Gene Name: PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ]
Official Symbol: PPP2CB
Synonyms: PPP2CB; protein phosphatase 2, catalytic subunit, beta isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; PP2Abeta; protein phosphatase 2A catalytic subuni
Gene ID: 5516
mRNA Refseq: NM_001009552
Protein Refseq: NP_001009552
MIM: 176916
Uniprot ID: P62714
Chromosome Location: 8p12
Pathway: Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function: hydrolase activity; metal ion binding; protein C-terminus binding; protein binding; contributes_to protein serine/threonine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.