Recombinant Human PPP2CB
Cat.No. : | PPP2CB-27931TH |
Product Overview : | Recombinant full length Human PPP2CB withan N terminal proprietary tag; Predicted MWt 59.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. |
Protein length : | 309 amino acids |
Molecular Weight : | 59.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILT KESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNY LFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD GQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLW SDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
Sequence Similarities : | Belongs to the PPP phosphatase family. PP-1 subfamily. |
Gene Name : | PPP2CB protein phosphatase 2, catalytic subunit, beta isozyme [ Homo sapiens ] |
Official Symbol : | PPP2CB |
Synonyms : | PPP2CB; protein phosphatase 2, catalytic subunit, beta isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; PP2Abeta; protein phosphatase 2A catalytic subuni |
Gene ID : | 5516 |
mRNA Refseq : | NM_001009552 |
Protein Refseq : | NP_001009552 |
MIM : | 176916 |
Uniprot ID : | P62714 |
Chromosome Location : | 8p12 |
Pathway : | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
Function : | hydrolase activity; metal ion binding; protein C-terminus binding; protein binding; contributes_to protein serine/threonine phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
PPP2CB-3388R | Recombinant Rhesus Macaque PPP2CB Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2CB-2620H | Recombinant Human PPP2CB Protein, His-tagged | +Inquiry |
PPP2CB-1178H | Recombinant Human PPP2CB Protein (1-309 aa), GST-tagged | +Inquiry |
PPP2CB-4291R | Recombinant Rat PPP2CB Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2CB-7030M | Recombinant Mouse PPP2CB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
PPP2CB-2928HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
PPP2CB-2927HCL | Recombinant Human PPP2CB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All PPP2CB Products
Required fields are marked with *
My Review for All PPP2CB Products
Required fields are marked with *
0
Inquiry Basket