"PPP2R1A" Related Products

Expand
Expand

Recombinant Human PPP2R1A, His-tagged

Cat.No.: PPP2R1A-27571TH
Product Overview: Recombinant fragment, corresponding to amino acids 280-583 of Human PPP2R1A with N terminal His tag, 304 amino acids, 35kDa.
Description: This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRE NVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILG KDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVI GIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQ LGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKF GKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEV CGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGP ILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL
Gene Name: PPP2R1A protein phosphatase 2, regulatory subunit A, alpha [ Homo sapiens ]
Official Symbol: PPP2R1A
Synonyms: PPP2R1A; protein phosphatase 2, regulatory subunit A, alpha; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform , protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform; serine/threonine-protein phosphatase
Gene ID: 5518
mRNA Refseq: NM_014225
Protein Refseq: NP_055040
MIM: 605983
Uniprot ID: P30153
Chromosome Location: 19q13
Pathway: Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem;
Function: antigen binding; protein binding; protein heterodimerization activity; protein phosphatase type 2A regulator activity; protein serine/threonine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.