Recombinant Human PPP2R1A, His-tagged

• Cat.No.: PPP2R1A-27571TH
• Product Overview: Recombinant fragment, corresponding to amino acids 280-583 of Human PPP2R1A with N terminal His tag, 304 amino acids, 35kDa.

Specification

• Description: This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 96 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRE NVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILG KDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVI GIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQ LGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKF GKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEV CGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGP ILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL

Gene Information

• Gene Name: PPP2R1A protein phosphatase 2, regulatory subunit A, alpha [ Homo sapiens ]
• Official Symbol: PPP2R1A
• Synonyms: PPP2R1A; protein phosphatase 2, regulatory subunit A, alpha; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform , protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform; serine/threonine-protein phosphatase
• Gene ID: 5518
• mRNA Refseq: NM_014225
• Protein Refseq: NP_055040
• MIM: 605983
• Uniprot ID: P30153
• Chromosome Location: 19q13
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem
• Function: antigen binding; protein binding; protein heterodimerization activity; protein phosphatase type 2A regulator activity; protein serine/threonine phosphatase activity