"PPP3R1" Related Products

Expand
Expand

Recombinant Human PPP3R1, His-tagged

Cat.No.: PPP3R1-27208TH
Product Overview: Recombinant full length Human Calcineurin B with N terminal His tag; 190 amino acids with tag, MWt 21.5 kDa inclusive of tag,
Description: PPP3R1, also known as Calcineurin subunit B type 1, is a Ser/Thr-specific calcium and calmodulin-dependent protein phosphatase that plays an essential role in the T cell activation pathway.
Protein length: 170 amino acids
Conjugation: HIS
Molecular Weight: 21.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Sequence Similarities: Belongs to the calcineurin regulatory subunit family.Contains 4 EF-hand domains.
Gene Name: PPP3R1 protein phosphatase 3, regulatory subunit B, alpha [ Homo sapiens ]
Official Symbol: PPP3R1
Synonyms: PPP3R1; protein phosphatase 3, regulatory subunit B, alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) , protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcine
Gene ID: 5534
mRNA Refseq: NM_000945
Protein Refseq: NP_000936
MIM: 601302
Uniprot ID: P63098
Chromosome Location: 2p14
Pathway: Activation of BAD and translocation to mitochondria, organism-specific biosystem; Activation of BH3-only proteins, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem;
Function: calcium ion binding; calcium-dependent protein serine/threonine phosphatase activity; calmodulin binding; phosphoprotein phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.