Recombinant Human PRKAR1B, His-tagged

Cat.No. : PRKAR1B-28125TH
Product Overview : Recombinant fragment, corresponding to amino acids 229-381 of Human PKA regulatory subunit I beta with N terminal His tag, 153 amino acids, 24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 229-381 a.a.
Description : Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion transport, and gene transcription. The PKA holoenzyme is composed of 2 regulatory and 2 catalytic subunits and dissociates from the regulatory subunits upon binding of cAMP.
Conjugation : HIS
Tissue specificity : Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
Form : Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVA DALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRR SPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGP LKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV
Sequence Similarities : Belongs to the cAMP-dependent kinase regulatory chain family.Contains 2 cyclic nucleotide-binding domains.
Gene Name PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta [ Homo sapiens ]
Official Symbol PRKAR1B
Synonyms PRKAR1B; protein kinase, cAMP-dependent, regulatory, type I, beta; cAMP-dependent protein kinase type I-beta regulatory subunit;
Gene ID 5575
mRNA Refseq NM_001164758
Protein Refseq NP_001158230
MIM 176911
Uniprot ID P31321
Chromosome Location 7pter-p22
Pathway Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Aquaporin-mediated transport, organism-specific biosystem; Ca-dependent events, organism-specific biosystem; CaM pathway, organism-specific biosystem;
Function cAMP binding; cAMP-dependent protein kinase regulator activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKAR1B Products

Required fields are marked with *

My Review for All PRKAR1B Products

Required fields are marked with *

0
cart-icon