Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PRKAR1B, His-tagged

Cat.No. : PRKAR1B-28125TH
Product Overview : Recombinant fragment, corresponding to amino acids 229-381 of Human PKA regulatory subunit I beta with N terminal His tag, 153 amino acids, 24kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion transport, and gene transcription. The PKA holoenzyme is composed of 2 regulatory and 2 catalytic subunits and dissociates from the regulatory subunits upon binding of cAMP.
Conjugation : HIS
Source : E. coli
Tissue specificity : Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
Form : Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVA DALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRR SPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGP LKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV
Sequence Similarities : Belongs to the cAMP-dependent kinase regulatory chain family.Contains 2 cyclic nucleotide-binding domains.
Gene Name : PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta [ Homo sapiens ]
Official Symbol : PRKAR1B
Synonyms : PRKAR1B; protein kinase, cAMP-dependent, regulatory, type I, beta; cAMP-dependent protein kinase type I-beta regulatory subunit;
Gene ID : 5575
mRNA Refseq : NM_001164758
Protein Refseq : NP_001158230
MIM : 176911
Uniprot ID : P31321
Chromosome Location : 7pter-p22
Pathway : Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Aquaporin-mediated transport, organism-specific biosystem; Ca-dependent events, organism-specific biosystem; CaM pathway, organism-specific biosystem;
Function : cAMP binding; cAMP-dependent protein kinase regulator activity; nucleotide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends