Recombinant Human PRKAR1B, His-tagged
Cat.No. : | PRKAR1B-28125TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 229-381 of Human PKA regulatory subunit I beta with N terminal His tag, 153 amino acids, 24kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 229-381 a.a. |
Description : | Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion transport, and gene transcription. The PKA holoenzyme is composed of 2 regulatory and 2 catalytic subunits and dissociates from the regulatory subunits upon binding of cAMP. |
Conjugation : | HIS |
Tissue specificity : | Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible. |
Form : | Lyophilised:Reconstitute with 135 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVA DALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRR SPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGP LKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV |
Sequence Similarities : | Belongs to the cAMP-dependent kinase regulatory chain family.Contains 2 cyclic nucleotide-binding domains. |
Gene Name | PRKAR1B protein kinase, cAMP-dependent, regulatory, type I, beta [ Homo sapiens ] |
Official Symbol | PRKAR1B |
Synonyms | PRKAR1B; protein kinase, cAMP-dependent, regulatory, type I, beta; cAMP-dependent protein kinase type I-beta regulatory subunit; |
Gene ID | 5575 |
mRNA Refseq | NM_001164758 |
Protein Refseq | NP_001158230 |
MIM | 176911 |
Uniprot ID | P31321 |
Chromosome Location | 7pter-p22 |
Pathway | Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Aquaporin-mediated transport, organism-specific biosystem; Ca-dependent events, organism-specific biosystem; CaM pathway, organism-specific biosystem; |
Function | cAMP binding; cAMP-dependent protein kinase regulator activity; nucleotide binding; |
◆ Recombinant Proteins | ||
PRKAR1B-4514Z | Recombinant Zebrafish PRKAR1B | +Inquiry |
PRKAR1B-7015H | Recombinant Human PRKAR1B, His-tagged | +Inquiry |
PRKAR1B-1951H | Recombinant Human PRKAR1B, GST-tagged | +Inquiry |
Prkar1b-5115M | Recombinant Mouse Prkar1b Protein, Myc/DDK-tagged | +Inquiry |
PRKAR1B-28125TH | Recombinant Human PRKAR1B, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKAR1B-2862HCL | Recombinant Human PRKAR1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKAR1B Products
Required fields are marked with *
My Review for All PRKAR1B Products
Required fields are marked with *