"PRMT2" Related Products

Expand

Recombinant Human PRMT2, His-tagged

Cat.No. : PRMT2-31115TH
Product Overview : Recombinant fragment, corresponding to amino acids 286-433 of Human PRMT2 with an N terminal His tag. Predicted MWt: 18 kDa;
Description : Protein arginine N-methyltransferase 2 is an enzyme that in humans is encoded by the PRMT2 gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 102 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGE LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGP FHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVW RRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Sequence Similarities : Belongs to the protein arginine N-methyltransferase family.Contains 1 SH3 domain.
Gene Name : PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
Official Symbol : PRMT2
Synonyms : PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373;
Gene ID : 3275
mRNA Refseq : NM_001242864
Protein Refseq : NP_001229793
MIM : 601961
Uniprot ID : P55345
Chromosome Location : 21q22.3
Pathway : mRNA processing, organism-specific biosystem;
Function : androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.