Recombinant Human PRMT2, His-tagged

Cat.No. : PRMT2-31115TH
Product Overview : Recombinant fragment, corresponding to amino acids 286-433 of Human PRMT2 with an N terminal His tag. Predicted MWt: 18 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 286-433 a.a.
Description : Protein arginine N-methyltransferase 2 is an enzyme that in humans is encoded by the PRMT2 gene.
Conjugation : HIS
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 102 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGE LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGP FHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVW RRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Sequence Similarities : Belongs to the protein arginine N-methyltransferase family.Contains 1 SH3 domain.
Gene Name PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
Official Symbol PRMT2
Synonyms PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373;
Gene ID 3275
mRNA Refseq NM_001242864
Protein Refseq NP_001229793
MIM 601961
Uniprot ID P55345
Chromosome Location 21q22.3
Pathway mRNA processing, organism-specific biosystem;
Function androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT2 Products

Required fields are marked with *

My Review for All PRMT2 Products

Required fields are marked with *

0
cart-icon