"PRODH" Related Products

Expand
Expand

Recombinant Human PRODH

Cat.No.: PRODH-31088TH
Product Overview: Recombinant fragment of Human PRODH with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag.
Description: This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in lung, skeletal muscle and brain, to a lesser extent in heart and kidney, and weakly in liver, placenta and pancreas.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQ
Sequence Similarities: Belongs to the proline oxidase family.
Gene Name: PRODH proline dehydrogenase (oxidase) 1 [ Homo sapiens ]
Official Symbol: PRODH
Synonyms: PRODH; proline dehydrogenase (oxidase) 1; proline dehydrogenase (proline oxidase ); proline dehydrogenase 1, mitochondrial; HSPOX2; PIG6; PRODH1; PRODH2; TP53I6;
Gene ID: 5625
mRNA Refseq: NM_001195226
Protein Refseq: NP_001182155
MIM: 606810
Uniprot ID: O43272
Chromosome Location: 22q11.2
Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem;
Function: oxidoreductase activity; proline dehydrogenase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.