Recombinant Human PRODH
Cat.No. : | PRODH-31088TH |
Product Overview : | Recombinant fragment of Human PRODH with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in lung, skeletal muscle and brain, to a lesser extent in heart and kidney, and weakly in liver, placenta and pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQ |
Sequence Similarities : | Belongs to the proline oxidase family. |
Gene Name | PRODH proline dehydrogenase (oxidase) 1 [ Homo sapiens ] |
Official Symbol | PRODH |
Synonyms | PRODH; proline dehydrogenase (oxidase) 1; proline dehydrogenase (proline oxidase ); proline dehydrogenase 1, mitochondrial; HSPOX2; PIG6; PRODH1; PRODH2; TP53I6; |
Gene ID | 5625 |
mRNA Refseq | NM_001195226 |
Protein Refseq | NP_001182155 |
MIM | 606810 |
Uniprot ID | O43272 |
Chromosome Location | 22q11.2 |
Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; |
Function | oxidoreductase activity; proline dehydrogenase activity; |
◆ Recombinant Proteins | ||
Prodh-8048M | Recombinant Mouse Prodh protein, His & T7-tagged | +Inquiry |
PRODH-31088TH | Recombinant Human PRODH | +Inquiry |
PRODH-7130M | Recombinant Mouse PRODH Protein, His (Fc)-Avi-tagged | +Inquiry |
PRODH-13428M | Recombinant Mouse PRODH Protein | +Inquiry |
PRODH-326H | Recombinant Full Length Human PRODH Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRODH-502HCL | Recombinant Human PRODH lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRODH Products
Required fields are marked with *
My Review for All PRODH Products
Required fields are marked with *