Recombinant Human PRODH

Cat.No. : PRODH-31088TH
Product Overview : Recombinant fragment of Human PRODH with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in lung, skeletal muscle and brain, to a lesser extent in heart and kidney, and weakly in liver, placenta and pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQ
Sequence Similarities : Belongs to the proline oxidase family.
Gene Name PRODH proline dehydrogenase (oxidase) 1 [ Homo sapiens ]
Official Symbol PRODH
Synonyms PRODH; proline dehydrogenase (oxidase) 1; proline dehydrogenase (proline oxidase ); proline dehydrogenase 1, mitochondrial; HSPOX2; PIG6; PRODH1; PRODH2; TP53I6;
Gene ID 5625
mRNA Refseq NM_001195226
Protein Refseq NP_001182155
MIM 606810
Uniprot ID O43272
Chromosome Location 22q11.2
Pathway Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem;
Function oxidoreductase activity; proline dehydrogenase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRODH Products

Required fields are marked with *

My Review for All PRODH Products

Required fields are marked with *

0
cart-icon
0
compare icon