Recombinant Human PRODH

• Cat.No.: PRODH-31088TH
• Product Overview: Recombinant fragment of Human PRODH with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed in lung, skeletal muscle and brain, to a lesser extent in heart and kidney, and weakly in liver, placenta and pancreas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQ
• Sequence Similarities: Belongs to the proline oxidase family.

Gene Information

• Gene Name: PRODH proline dehydrogenase (oxidase) 1 [ Homo sapiens ]
• Official Symbol: PRODH
• Synonyms: PRODH; proline dehydrogenase (oxidase) 1; proline dehydrogenase (proline oxidase ); proline dehydrogenase 1, mitochondrial; HSPOX2; PIG6; PRODH1; PRODH2; TP53I6
• Gene ID: 5625
• mRNA Refseq: NM_001195226
• Protein Refseq: NP_001182155
• MIM: 606810
• Uniprot ID: O43272
• Chromosome Location: 22q11.2
• Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem
• Function: oxidoreductase activity; proline dehydrogenase activity